Back to all directories

ToolScout Review: Should You List Your SaaS?

toolscout.ai

Unlock the power of AI with us and explore hundreds of AI Tools and News updated Daily.

Want to compare more options? View the full list.

ToolScout

This directory has not been manually checked yet.
Domain Rating25
Traffic7kavg. monthly visits
Dofollow backlink

Pricing

ToolScout is listed as free, so there is no payment expected and no badge requirement noted in this list.

Traffic Trend

Monthly visits are estimated from Ahrefs organic traffic with a conservative multiplier. Treat them as directional.

Feb 20262kMar 202629.1kApr 20262kMay 20263kJun 20262kJul 20262k

Top Organic Pages

Ahrefs estimates which pages capture the most organic search traffic. This helps check whether visitors land on listing pages, the homepage, or the submission flow.

Search Demand

Top Similarweb keywords can hint at why people land on this platform and whether that search intent overlaps with your SaaS.

fiddlartacademyncchatfaideepswapfacefiddl art

Verdict

Should You Submit Your SaaS to ToolScout?

Probably. ToolScout can still be useful if the listing page is public and relevant to your product. I would prioritize it after the easier free platforms with stronger traffic signals.

Next step: open ToolScout, or compare the full directory list.